PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10016335m
Common NameCARUB_v10016335mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 150aa    MW: 17282.6 Da    PI: 9.9515
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10016335mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.64.6e-3270128159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK vk++ fprsYY+Ct++gC+vkk+v+r + d+ vv++tY+g H+h+
  Carubv10016335m  70 LDDGYRWRKYGQKAVKNNLFPRSYYKCTQEGCRVKKQVQRLSGDEGVVVTTYQGAHTHP 128
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.4E-3355128IPR003657WRKY domain
SuperFamilySSF1182907.72E-2962129IPR003657WRKY domain
PROSITE profilePS5081129.50565130IPR003657WRKY domain
SMARTSM007743.9E-3770129IPR003657WRKY domain
PfamPF031063.3E-2671128IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006817Biological Processphosphate ion transport
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MEERCQVLFP CSSSDHGVDK RTWCAAQPTT TSSLSDQKMK NKEEGKPKSR KKKEREAKFA  60
FQTRSQVDIL DDGYRWRKYG QKAVKNNLFP RSYYKCTQEG CRVKKQVQRL SGDEGVVVTT  120
YQGAHTHPVD KPSDNFHHIL TQMHIFPPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-2760127774Probable WRKY transcription factor 4
2lex_A3e-2760127774Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00325DAPTransfer from AT3G01970Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC2465801e-110KC246580.1 Brassica napus WRKY transcription factor 45.1 (WRKY45.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006300107.11e-111hypothetical protein CARUB_v10016335mg
SwissprotQ9S7637e-68WRK45_ARATH; Probable WRKY transcription factor 45
TrEMBLR0I4U41e-111R0I4U4_9BRAS; Uncharacterized protein
STRINGscaffold_300012.12e-71(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50928154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01970.19e-67WRKY DNA-binding protein 45